Recombinant Human CA125/MUC16 Protein

Product Discontinued

Recombinant Human CA125/MUC16 Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1321-1415 of Human CA125/MUC16
  
  

  Source: Wheat Germ

  Amino Acid Sequence: VSRTEVMPSSRTSIPGPAQSTMSLDISDEVVTRLSTSPIMTESAEITITTQTGYSLATSQVTLPLGTSMTFLSGTHSTMSQGLSHSEMTNLMSRG

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: MUC16
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 36.19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CA125/MUC16 Protein

• CA125 ovarian cancer antigen
• CA125
• CA-125
• CA125MUC-16
• FLJ14303
• MUC16
• mucin 16, cell surface associated
• mucin-16
• Ovarian cancer-related tumor marker CA125
• Ovarian carcinoma antigen CA125

Background

MUC16 (CA125) is a serum marker that is used routinely in gynecologic practice to monitor patients with ovarian cancer. It is a mullerian duct differentiation antigen that is over expressed in epithelial ovarian cancer cells and secreted into the blood, although its expression is not entirely confined to ovarian cancer. Most biochemical studies have concluded that MUC16 is a high molecular mass glycoprotein, although estimates of its size range from 200 to 2000 kDa with smaller "subunits" being described by some investigators.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MUC16
• Uniprot:
  • Q8WXI7()