Recombinant Human C9orf4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C9orf4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 158-267 of Human C9orf4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FRRS1L
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C9orf4 Protein

  • Brain protein CG-6
  • C9orf4
  • CG6
  • CG-6
  • chromosome 9 open reading frame 4
  • ferric-chelate reductase 1-like
  • hypothetical protein LOC23732

Background

C9orf4 - chromosome 9 open reading frame 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01020
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NB500-704
Species: Hu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84530
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83988
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56320
Species: Hu
Applications: WB
NBL1-13885
Species: Hu
NBP1-31386
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00023732-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for C9orf4 Partial Recombinant Protein (H00023732-Q01) (0)

There are no publications for C9orf4 Partial Recombinant Protein (H00023732-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C9orf4 Partial Recombinant Protein (H00023732-Q01) (0)

There are no reviews for C9orf4 Partial Recombinant Protein (H00023732-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C9orf4 Partial Recombinant Protein (H00023732-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C9orf4 Products

Bioinformatics Tool for C9orf4 Partial Recombinant Protein (H00023732-Q01)

Discover related pathways, diseases and genes to C9orf4 Partial Recombinant Protein (H00023732-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C9orf4 Partial Recombinant Protein (H00023732-Q01)

Discover more about diseases related to C9orf4 Partial Recombinant Protein (H00023732-Q01).

Blogs on C9orf4

There are no specific blogs for C9orf4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

C9orf4 Antibody
NBP2-58836

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C9orf4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FRRS1L