C9orf100 Antibody

Images

 
Immunohistochemistry-Paraffin: C9orf100 Antibody [NBP2-31850] - Staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C9orf100 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ELLPYLEGGCWGQGLEGFCRHLELYNQFAANSERSQTTLQEQLKKNKGFRRFVRLQEGRPEFGGLQLQDLLPLPLQRLQQYENLVVAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF39
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C9orf100 Protein (NBP2-31850PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C9orf100 Antibody

  • C9orf100
  • chromosome 9 open reading frame 100
  • FLJ14642
  • MGC44886
  • Rho guanine nucleotide exchange factor (GEF) 39
  • RP11-331F9.7
  • vav-like protein C9orf100

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2364
Species: Hu
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for C9orf100 Antibody (NBP2-31850) (0)

There are no publications for C9orf100 Antibody (NBP2-31850).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C9orf100 Antibody (NBP2-31850) (0)

There are no reviews for C9orf100 Antibody (NBP2-31850). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C9orf100 Antibody (NBP2-31850) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C9orf100 Products

Bioinformatics Tool for C9orf100 Antibody (NBP2-31850)

Discover related pathways, diseases and genes to C9orf100 Antibody (NBP2-31850). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C9orf100

There are no specific blogs for C9orf100, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C9orf100 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGEF39
Uniprot