C7orf64 Antibody


Immunocytochemistry/ Immunofluorescence: C7orf64 Antibody [NBP1-84150] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: C7orf64 Antibody [NBP1-84150] - Staining of human cerebral cortex shows cytoplasmic positivity in neuronal cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

C7orf64 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MDEQSFFGGLLHVCYAPEFETVEETRKKLQMRKAYVVKTTENKDHYVTKKKLVTEHKDTEDFRQDFHSEMSGF
Specificity of human C7orf64 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C7orf64 Protein (NBP1-84150PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C7orf64 Antibody

  • C7orf64
  • chromosome 7 open reading frame 64
  • DKFZp564O0523
  • DKFZp686D1651
  • HSPC304
  • hypothetical protein LOC84060
  • RNA binding motif protein 48


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C7orf64 Antibody (NBP1-84150) (0)

There are no publications for C7orf64 Antibody (NBP1-84150).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C7orf64 Antibody (NBP1-84150) (0)

There are no reviews for C7orf64 Antibody (NBP1-84150). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C7orf64 Antibody (NBP1-84150) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C7orf64 Products

Bioinformatics Tool for C7orf64 Antibody (NBP1-84150)

Discover related pathways, diseases and genes to C7orf64 Antibody (NBP1-84150). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C7orf64

There are no specific blogs for C7orf64, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C7orf64 Antibody and receive a gift card or discount.


Gene Symbol RBM48