C7orf59 Antibody

Images

 
Western Blot: C7orf59 Antibody [NBP1-98263] - Titration: 1.0 ug/ml Positive Control: Mouse Heart.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C7orf59 Antibody Summary

Immunogen
The immunogen for this antibody is UPF0539 protein C7orf59 N-terminal region. Peptide sequence MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LAMTOR4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Positive Control
C7orf59 Lysate (NBP2-65596)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C7orf59 Antibody

  • C7orf59
  • chromosome 7 open reading frame 59
  • hypothetical protein LOC389541
  • late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
  • MGC163425
  • MGC163431

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, EM, ELISA, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
H00010670-P01
Species: Hu
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00010542-M12
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for C7orf59 Antibody (NBP1-98263) (0)

There are no publications for C7orf59 Antibody (NBP1-98263).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C7orf59 Antibody (NBP1-98263) (0)

There are no reviews for C7orf59 Antibody (NBP1-98263). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C7orf59 Antibody (NBP1-98263) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional C7orf59 Products

Bioinformatics Tool for C7orf59 Antibody (NBP1-98263)

Discover related pathways, diseases and genes to C7orf59 Antibody (NBP1-98263). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C7orf59

There are no specific blogs for C7orf59, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C7orf59 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LAMTOR4
Uniprot