C7orf44 Antibody

Images

 
Western Blot: C7orf44 Antibody [NBP1-83830] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: C7orf44 Antibody [NBP1-83830] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: C7orf44 Antibody [NBP1-83830] - Staining of human stomach shows strong cytoplasmic positivity in granular pattern in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C7orf44 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C7orf44 Protein (NBP1-83830PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C7orf44 Antibody

  • C7orf44
  • chromosome 7 open reading frame 44
  • cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae)
  • FLJ10803
  • hypothetical protein LOC55744

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85500
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-30971
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59560
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86322
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30005
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001353-B02P
Species: Hu
Applications: WB, ICC/IF
NBP1-77393
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C7orf44 Antibody (NBP1-83830) (0)

There are no publications for C7orf44 Antibody (NBP1-83830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C7orf44 Antibody (NBP1-83830) (0)

There are no reviews for C7orf44 Antibody (NBP1-83830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C7orf44 Antibody (NBP1-83830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C7orf44 Products

Bioinformatics Tool for C7orf44 Antibody (NBP1-83830)

Discover related pathways, diseases and genes to C7orf44 Antibody (NBP1-83830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C7orf44 Antibody (NBP1-83830)

Discover more about diseases related to C7orf44 Antibody (NBP1-83830).
 

Pathways for C7orf44 Antibody (NBP1-83830)

View related products by pathway.

Research Areas for C7orf44 Antibody (NBP1-83830)

Find related products by research area.

Blogs on C7orf44

There are no specific blogs for C7orf44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C7orf44 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COA1