C7orf43 Antibody

Images

 
Western Blot: C7orf43 Antibody [NBP1-70479] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml C7orf43 is supported by BioGPS gene expression data to be expressed in HepG2.
Western Blot: C7orf43 Antibody [NBP1-70479] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.
Western Blot: C7orf43 Antibody [NBP1-70479] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Product Discontinued
View other related C7orf43 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-70479
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C7orf43 Antibody Summary

Immunogen
Synthetic peptides corresponding to C7ORF43 The peptide sequence was selected from the middle region of C7ORF43. Peptide sequence DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL.
Clonality
Polyclonal
Host
Rabbit
Gene
C7ORF43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C7orf43 and was validated on Western blot.
Theoretical MW
62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C7orf43 Antibody

  • chromosome 7 open reading frame 43

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C7orf43 Antibody (NBP1-70479) (0)

There are no publications for C7orf43 Antibody (NBP1-70479).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C7orf43 Antibody (NBP1-70479) (0)

There are no reviews for C7orf43 Antibody (NBP1-70479). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C7orf43 Antibody (NBP1-70479) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C7orf43 Products

Bioinformatics Tool for C7orf43 Antibody (NBP1-70479)

Discover related pathways, diseases and genes to C7orf43 Antibody (NBP1-70479). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C7orf43

There are no specific blogs for C7orf43, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C7orf43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C7ORF43