C6orf97 Antibody

Images

 
Western Blot: C6orf97 Antibody [NBP2-48579] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: C6orf97 Antibody [NBP2-48579] - Staining of human fallopian tube shows strong cilia positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf97 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:ETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC170
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
C6orf97 Recombinant Protein Antigen (NBP2-48579PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf97 Antibody

  • bA282P11.1
  • C6orf97
  • chromosome 6 open reading frame 97
  • coiled-coil domain containing 170
  • FLJ23305
  • hypothetical protein LOC80129

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
7268-CT
NBP1-86676
Species: Hu
Applications: Simple Western, IHC, IHC-P
NBP1-82277
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-30451
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB7547
Species: Hu
Applications: WB, ICC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-85318
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56494
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-74048
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IP

Publications for C6orf97 Antibody (NBP2-48579) (0)

There are no publications for C6orf97 Antibody (NBP2-48579).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf97 Antibody (NBP2-48579) (0)

There are no reviews for C6orf97 Antibody (NBP2-48579). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C6orf97 Antibody (NBP2-48579) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C6orf97 Products

Bioinformatics Tool for C6orf97 Antibody (NBP2-48579)

Discover related pathways, diseases and genes to C6orf97 Antibody (NBP2-48579). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C6orf97

There are no specific blogs for C6orf97, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf97 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC170