C6orf27 Antibody

Images

 
Immunohistochemistry: C6orf27 Antibody [NBP2-30518] - Staining of human vagina shows moderate nuclear positivity in a subset of squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf27 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVFSVDGLLQKITVRIHGDISSFWIKNPAGVSQGQEEGGGPLGHTRRFGQFWMVTMDDPPQTGTWEIQVTAEDTPGVRVQAQTSLDFLFHFGIPMEDGPHPGLYPLTQPVAG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VWA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C6orf27 Recombinant Protein Antigen (NBP2-30518PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf27 Antibody

  • Chromosome 6 Open Reading Frame 27
  • G7C
  • NG37
  • Protein G7c
  • Von Willebrand Factor A Domain Containing 7
  • Von Willebrand Factor A Domain-Containing Protein 7
  • VWA7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13513
Species: Hu
Applications: WB, AG, ICC/IF, IHC, IHC-P
NBP2-49627
Species: Hu
Applications: WB, IHC
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
MAB5756
Species: Hu
Applications: Flow
NBP2-57274
Species: Hu
Applications: WB, ICC/IF
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00002968-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-86019
Species: Hu, Ca
Applications: WB, ICC/IF, IHC, IHC-P
AF6349
Species: Hu, Mu, Rt
Applications: WB
NBP2-38093
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-58095
Species: Hu
Applications: WB
MAB1599
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF7895
Species: Hu
Applications: WB, IHC
NBP2-30518
Species: Hu
Applications: IHC, IHC-P

Publications for C6orf27 Antibody (NBP2-30518) (0)

There are no publications for C6orf27 Antibody (NBP2-30518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf27 Antibody (NBP2-30518) (0)

There are no reviews for C6orf27 Antibody (NBP2-30518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C6orf27 Antibody (NBP2-30518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C6orf27 Products

Bioinformatics Tool for C6orf27 Antibody (NBP2-30518)

Discover related pathways, diseases and genes to C6orf27 Antibody (NBP2-30518). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C6orf27

There are no specific blogs for C6orf27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VWA7
Uniprot