C6orf204/CEP85L Antibody

Images

 
Immunohistochemistry-Paraffin: C6orf204/CEP85L Antibody [NBP1-90779] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf204/CEP85L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LDCKYKFESCSKEDFRASSSTLRRQPVDMTYSALPESKPIMTSSEAFEPPKYLMLGQQAVGGVPIQPSVRTQMW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEP85L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C6orf204/CEP85L Protein (NBP1-90779PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf204/CEP85L Antibody

  • bA57K17.2
  • C6orf204
  • centrosomal protein 85kDa-like
  • CEP85L
  • chromosome 6 open reading frame 204
  • NY-BR-15
  • RP11-57K17.2
  • serologically defined breast cancer antigen NY-BR-15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB100-757
Species: Hu
Applications: WB, IHC-P
AF6869
Species: Hu
Applications: WB
NBP1-83810
Species: Hu
Applications: IHC, IHC-P
NBP2-01826
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36746
Species: Hu
Applications: WB, IHC, IHC-P
AF5286
Species: Hu
Applications: WB
NBP1-86755
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
NBP2-52737
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80643
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84312
Species: Hu
Applications: WB, IHC, IHC-P
H00056996-R01
Species: Hu

Publications for C6orf204/CEP85L Antibody (NBP1-90779) (0)

There are no publications for C6orf204/CEP85L Antibody (NBP1-90779).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf204/CEP85L Antibody (NBP1-90779) (0)

There are no reviews for C6orf204/CEP85L Antibody (NBP1-90779). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C6orf204/CEP85L Antibody (NBP1-90779) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C6orf204/CEP85L Products

Bioinformatics Tool for C6orf204/CEP85L Antibody (NBP1-90779)

Discover related pathways, diseases and genes to C6orf204/CEP85L Antibody (NBP1-90779). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C6orf204/CEP85L

There are no specific blogs for C6orf204/CEP85L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf204/CEP85L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEP85L