C6orf1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C6orf1 Antibody [NBP1-90343] - Staining of human cell line A-431 shows positivity in vesicles.
Immunohistochemistry-Paraffin: C6orf1 Antibody [NBP1-90343] - Staining of human hippocampus shows strong nuclear positivity in neuronal cells.
Immunocytochemistry/ Immunofluorescence: C6orf1 Antibody [NBP1-90343] - Immunofluorescent staining of human cell line RH-30 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C6orf1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDYLRSAKMTEVMMNTQPMEEIGLSPRKDGLSYQIFPDPSDFDRCCKLKDRLPSIVVEPTEGEVESGELRWPPEEFLVQEDEQDNCEETAKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C6orf1 Protein (NBP1-90343PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C6orf1 Antibody

  • chromosome 6 open reading frame 1
  • hypothetical protein LOC221491
  • LBH
  • LBHMGC57858
  • Protein LBH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88640
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF8016
Species: Hu
Applications: WB, IHC
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-17086
Species: Hu, Mu, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-48024
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-56468
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90343
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for C6orf1 Antibody (NBP1-90343) (0)

There are no publications for C6orf1 Antibody (NBP1-90343).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C6orf1 Antibody (NBP1-90343) (0)

There are no reviews for C6orf1 Antibody (NBP1-90343). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C6orf1 Antibody (NBP1-90343) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C6orf1 Products

Bioinformatics Tool for C6orf1 Antibody (NBP1-90343)

Discover related pathways, diseases and genes to C6orf1 Antibody (NBP1-90343). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C6orf1

There are no specific blogs for C6orf1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C6orf1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6ORF1