C5orf42 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C5orf42 Antibody [NBP2-32673] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: C5orf42 Antibody [NBP2-32673] - Staining of human stomach, upper shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C5orf42 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LREHELNSLLFDVHTTLKRHQSKTKSQNVFRAGSCFVVAPESYESEKSSSLNDEYGMHLENQKLSSSVLVNQGIKPFLQYPSNEVNKNEGMSGLFG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C5orf42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C5orf42 Protein (NBP2-32673PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C5orf42 Antibody

  • chromosome 5 open reading frame 42
  • FLJ21126
  • hypothetical protein LOC65250
  • JBTS17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-407
Species: Hu, Mu, Rt, Bv, Ch, Ze
Applications: WB, ICC/IF
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-86991
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-91905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42657
Species: Hu
Applications: IP (-), WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32083
Species: Hu
Applications: WB, ICC/IF
NBP2-15309
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84403
Species: Hu
Applications: IHC, IHC-P
NBP1-51689
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90063
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93673
Species: Hu
Applications: IHC, IHC-P
NBP1-77182
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP1-81406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16035
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33877
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32673
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for C5orf42 Antibody (NBP2-32673) (0)

There are no publications for C5orf42 Antibody (NBP2-32673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C5orf42 Antibody (NBP2-32673) (0)

There are no reviews for C5orf42 Antibody (NBP2-32673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C5orf42 Antibody (NBP2-32673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C5orf42 Products

Bioinformatics Tool for C5orf42 Antibody (NBP2-32673)

Discover related pathways, diseases and genes to C5orf42 Antibody (NBP2-32673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C5orf42 Antibody (NBP2-32673)

Discover more about diseases related to C5orf42 Antibody (NBP2-32673).
 

Pathways for C5orf42 Antibody (NBP2-32673)

View related products by pathway.

Blogs on C5orf42

There are no specific blogs for C5orf42, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C5orf42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C5orf42