C4orf51 Antibody

Images

 
Immunohistochemistry-Paraffin: C4orf51 Antibody [NBP2-14702] Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C4orf51 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FPTPPNYGKYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSE DSEADRYSDYGWGGPSSPFN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4orf51
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C4orf51 Protein (NBP2-14702PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C4orf51 Antibody

  • C4orf51 chromosome 4 open reading frame 51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C4orf51 Antibody (NBP2-14702) (0)

There are no publications for C4orf51 Antibody (NBP2-14702).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4orf51 Antibody (NBP2-14702) (0)

There are no reviews for C4orf51 Antibody (NBP2-14702). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C4orf51 Antibody (NBP2-14702) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C4orf51 Products

C4orf51 NBP2-14702

Bioinformatics Tool for C4orf51 Antibody (NBP2-14702)

Discover related pathways, diseases and genes to C4orf51 Antibody (NBP2-14702). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C4orf51

There are no specific blogs for C4orf51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C4orf51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4orf51