C2orf57 Antibody

Images

 
Immunohistochemistry-Paraffin: C2orf57 Antibody [NBP2-14406] Staining of human testis shows distinct positivity in a subset of cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C2orf57 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LGNVDDSRSKDSPAGEPQGQVPLTADVLAVSSSVASTDWQDIDQASFKTA TPRAISTSGDKDKSAVVPEHGQKTPRKITPLLPSQNPSPLQVS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C2ORF57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C2orf57 Protein (NBP2-14406PEP)
Publications
Read Publication using NBP2-14406.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C2orf57 Antibody

  • chromosome 2 open reading frame 57
  • hypothetical protein LOC165100
  • MGC35154

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C2orf57 Antibody (NBP2-14406)(1)

Reviews for C2orf57 Antibody (NBP2-14406) (0)

There are no reviews for C2orf57 Antibody (NBP2-14406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C2orf57 Antibody (NBP2-14406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C2orf57 Products

Bioinformatics Tool for C2orf57 Antibody (NBP2-14406)

Discover related pathways, diseases and genes to C2orf57 Antibody (NBP2-14406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C2orf57

There are no specific blogs for C2orf57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2orf57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C2ORF57