Recombinant Human C2orf47 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C2orf47 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-291 of Human FLJ22555 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MALAARLQPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFTSFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKSALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETNQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
C2ORF47
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Dilutions
  • Western Blot Western Blot
Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C2orf47 Protein

  • chromosome 2 open reading frame 47
  • DKFZp666A212
  • FLJ22555
  • hypothetical protein LOC79568

Background

FLJ22555( AAH17959, 1 a.a. - 292 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for C2orf47 Recombinant Protein (H00079568-P01) (0)

There are no publications for C2orf47 Recombinant Protein (H00079568-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2orf47 Recombinant Protein (H00079568-P01) (0)

There are no reviews for C2orf47 Recombinant Protein (H00079568-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C2orf47 Recombinant Protein (H00079568-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C2orf47 Products

Bioinformatics Tool for C2orf47 Recombinant Protein (H00079568-P01)

Discover related pathways, diseases and genes to C2orf47 Recombinant Protein (H00079568-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C2orf47 Recombinant Protein (H00079568-P01)

Find related products by research area.

Blogs on C2orf47

There are no specific blogs for C2orf47, but you can read our latest blog posts.

Customers Who Bought This Also Bought

C2orf47 Antibody
NBP2-56654

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C2orf47 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C2ORF47