C2orf37 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C2orf37 Antibody [NBP2-30715] - Staining of human cell line Hep G2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: C2orf37 Antibody [NBP2-30715] - Staining of human cerebral cortex shows no positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C2orf37 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EQETFKIVDYEDELDLLSVVAVTQIDAEGKAHLDFHCNEYGTLLKSIPLVESWDVTYSHEVYFDRDLVLHIEQKPNRVFSCYVYQMICD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCAF17
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C2orf37 Protein (NBP2-30715PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C2orf37 Antibody

  • Chromosome 2 Open Reading Frame 37
  • DCAF17
  • DDB1 And CUL4 Associated Factor 17
  • DDB1- And CUL4-Associated Factor 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81586
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12553
Species: Hu
MAB6967
Species: Hu
Applications: WB
NBP2-02677
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP1-06986
Species: Hu, Mu, Rt
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA
NBP2-30715
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for C2orf37 Antibody (NBP2-30715) (0)

There are no publications for C2orf37 Antibody (NBP2-30715).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C2orf37 Antibody (NBP2-30715) (0)

There are no reviews for C2orf37 Antibody (NBP2-30715). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C2orf37 Antibody (NBP2-30715) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C2orf37 Products

Bioinformatics Tool for C2orf37 Antibody (NBP2-30715)

Discover related pathways, diseases and genes to C2orf37 Antibody (NBP2-30715). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C2orf37

There are no specific blogs for C2orf37, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C2orf37 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCAF17
Uniprot