C22orf43 Antibody

Images

 
Western Blot: C22orf43 Antibody [NBP1-90938] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-77
Immunocytochemistry/ Immunofluorescence: C22orf43 Antibody [NBP1-90938] - Staining of human cell line U-2 OS shows positivity in nucleus and nucleoli.
Immunohistochemistry-Paraffin: C22orf43 Antibody [NBP1-90938] - Staining of human adrenal gland shows strong nuclear positivity in cortical cells.

Product Details

Summary
Product Discontinued
View other related C22orf43 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90938
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C22orf43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILPSRVQGGCYRFDSSSCSSEDNLSLVCLPRSEDDDCDDDDDDAQILPSRVQACSEDSLFLRCSLRHKDEEEEDDDD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C22ORF43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using NBP1-90938.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C22orf43 Antibody

  • chromosome 22 open reading frame 43
  • MGC33025
  • MGC75009
  • putative uncharacterized protein C22orf43

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C22orf43 Antibody (NBP1-90938)(1)

Reviews for C22orf43 Antibody (NBP1-90938) (0)

There are no reviews for C22orf43 Antibody (NBP1-90938). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C22orf43 Antibody (NBP1-90938) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C22orf43 Products

C22orf43 NBP1-90938

Bioinformatics Tool for C22orf43 Antibody (NBP1-90938)

Discover related pathways, diseases and genes to C22orf43 Antibody (NBP1-90938). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C22orf43

There are no specific blogs for C22orf43, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C22orf43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C22ORF43