C22orf25 Antibody

Images

 
Western Blot: C22orf25 Antibody [NBP1-70463] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C22orf25 Antibody Summary

Immunogen
Synthetic peptides corresponding to C22ORF25 The peptide sequence was selected from the N terminal of C22ORF25. Peptide sequence MCIIFFKFDPRPVSKNAYRLILAANRDEFYSRPSKLADFWGNNNEILSGL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TANGO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C22orf25 and was validated on Western blot.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for C22orf25 Antibody

  • chromosome 22 open reading frame 25

Background

The exact functions of C22orf25 remain unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C22orf25 Antibody (NBP1-70463) (0)

There are no publications for C22orf25 Antibody (NBP1-70463).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C22orf25 Antibody (NBP1-70463) (0)

There are no reviews for C22orf25 Antibody (NBP1-70463). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C22orf25 Antibody (NBP1-70463) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C22orf25 Products

Bioinformatics Tool for C22orf25 Antibody (NBP1-70463)

Discover related pathways, diseases and genes to C22orf25 Antibody (NBP1-70463). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C22orf25 Antibody (NBP1-70463)

Discover more about diseases related to C22orf25 Antibody (NBP1-70463).
 

Pathways for C22orf25 Antibody (NBP1-70463)

View related products by pathway.

Blogs on C22orf25

There are no specific blogs for C22orf25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C22orf25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TANGO2