c21orf63 Antibody


Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human rectum shows low expression as expected.
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules and glomeruli.
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human gallbladder shows high expression.
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining in human gallbladder and rectum tissues using anti-EVA1C antibody. Corresponding EVA1C RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

c21orf63 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
Specificity of human c21orf63 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
c21orf63 Protein (NBP1-88937PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for c21orf63 Antibody

  • B18
  • B19
  • C21orf63
  • C21orf64
  • chromosome 21 open reading frame 63
  • chromosome 21 open reading frame 64
  • EVA1
  • EVA-1
  • hypothetical protein LOC59271
  • PRED34
  • SUE21


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, Neut

Publications for c21orf63 Antibody (NBP1-88937) (0)

There are no publications for c21orf63 Antibody (NBP1-88937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for c21orf63 Antibody (NBP1-88937) (0)

There are no reviews for c21orf63 Antibody (NBP1-88937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for c21orf63 Antibody (NBP1-88937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional c21orf63 Products

Bioinformatics Tool for c21orf63 Antibody (NBP1-88937)

Discover related pathways, diseases and genes to c21orf63 Antibody (NBP1-88937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on c21orf63

There are no specific blogs for c21orf63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our c21orf63 Antibody and receive a gift card or discount.


Gene Symbol EVA1C