c21orf63 Antibody

Images

 
Immunohistochemistry-Paraffin: c21orf63 Antibody [NBP1-88937] - Staining of human kidney shows granular cytoplasmic positivity in cells in tubules and glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

c21orf63 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSESDFPGELSGFCRTSYPIYSSIEAAELAERIERREQIIQEIWMNSGLDTSLPRNMGQFY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EVA1C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
c21orf63 Protein (NBP1-88937PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for c21orf63 Antibody

  • B18
  • B19
  • C21orf63
  • C21orf64
  • chromosome 21 open reading frame 63
  • chromosome 21 open reading frame 64
  • EVA1
  • EVA-1
  • hypothetical protein LOC59271
  • PRED34
  • SUE21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24567
Species: Hu
Applications: WB
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-33626
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-88930
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut

Publications for c21orf63 Antibody (NBP1-88937) (0)

There are no publications for c21orf63 Antibody (NBP1-88937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for c21orf63 Antibody (NBP1-88937) (0)

There are no reviews for c21orf63 Antibody (NBP1-88937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for c21orf63 Antibody (NBP1-88937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional c21orf63 Products

Bioinformatics Tool for c21orf63 Antibody (NBP1-88937)

Discover related pathways, diseases and genes to c21orf63 Antibody (NBP1-88937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on c21orf63

There are no specific blogs for c21orf63, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our c21orf63 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EVA1C