C21orf33 Antibody (1F5) [PerCP]



Product Details

Product Discontinued
View other related C21orf33 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C21orf33 Antibody (1F5) [PerCP] Summary

C21orf33 (NP_004640 188 a.a. - 268 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
C21orf33 - chromosome 21 open reading frame 33
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Store at 4C in the dark.
0.05% Sodium Azide
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C21orf33 Antibody (1F5) [PerCP]

  • chromosome 21 open reading frame 33
  • D21S2048E
  • ES1
  • GT335
  • HES1
  • HES1KNP-Ia
  • human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335
  • Keio novel protein I
  • KNPH
  • KNPI
  • KNP-I
  • KNPImitochondrial
  • Protein KNP-I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P

Publications for C21orf33 Antibody (H00008209-M01PCP) (0)

There are no publications for C21orf33 Antibody (H00008209-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C21orf33 Antibody (H00008209-M01PCP) (0)

There are no reviews for C21orf33 Antibody (H00008209-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C21orf33 Antibody (H00008209-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C21orf33 Products

Bioinformatics Tool for C21orf33 Antibody (H00008209-M01PCP)

Discover related pathways, diseases and genes to C21orf33 Antibody (H00008209-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C21orf33 Antibody (H00008209-M01PCP)

Discover more about diseases related to C21orf33 Antibody (H00008209-M01PCP).

Pathways for C21orf33 Antibody (H00008209-M01PCP)

View related products by pathway.

PTMs for C21orf33 Antibody (H00008209-M01PCP)

Learn more about PTMs related to C21orf33 Antibody (H00008209-M01PCP).

Blogs on C21orf33

There are no specific blogs for C21orf33, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C21orf33 Antibody (1F5) [PerCP] and receive a gift card or discount.


Gene Symbol C21ORF33