C21orf33 Antibody (1F5) [DyLight 680]

Images

 

Product Details

Summary
Product Discontinued
View other related C21orf33 Primary Antibodies

Order Details


    • Catalog Number
      H00008209-M01FR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C21orf33 Antibody (1F5) [DyLight 680] Summary

Immunogen
C21orf33 (NP_004640 188 a.a. - 268 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK
Specificity
C21orf33 - chromosome 21 open reading frame 33
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
C21ORF33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C21orf33 Antibody (1F5) [DyLight 680]

  • chromosome 21 open reading frame 33
  • D21S2048E
  • ES1
  • GT335
  • HES1
  • HES1KNP-Ia
  • human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335
  • Keio novel protein I
  • KNPH
  • KNPI
  • KNP-I
  • KNPImitochondrial
  • Protein KNP-I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-41305
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
AF2567
Species: Mu
Applications: WB, IHC
AF4079
Species: Hu
Applications: WB, ICC
NB100-93551
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NBP2-27152
Species: Mu
Applications: WB
NBP1-84257
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83957
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00004854-M01
Species: Hu
Applications: WB, ELISA
AF3444
Species: Hu
Applications: WB
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-57809
Species: Hu
Applications: ICC/IF
NBP1-31318
Species: Mu
Applications: IHC-P
AF3970
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-89090
Species: Hu
Applications: IHC, IHC-P

Publications for C21orf33 Antibody (H00008209-M01FR) (0)

There are no publications for C21orf33 Antibody (H00008209-M01FR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C21orf33 Antibody (H00008209-M01FR) (0)

There are no reviews for C21orf33 Antibody (H00008209-M01FR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C21orf33 Antibody (H00008209-M01FR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C21orf33 Products

Bioinformatics Tool for C21orf33 Antibody (H00008209-M01FR)

Discover related pathways, diseases and genes to C21orf33 Antibody (H00008209-M01FR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C21orf33 Antibody (H00008209-M01FR)

Discover more about diseases related to C21orf33 Antibody (H00008209-M01FR).
 

Pathways for C21orf33 Antibody (H00008209-M01FR)

View related products by pathway.

PTMs for C21orf33 Antibody (H00008209-M01FR)

Learn more about PTMs related to C21orf33 Antibody (H00008209-M01FR).

Blogs on C21orf33

There are no specific blogs for C21orf33, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C21orf33 Antibody (1F5) [DyLight 680] and receive a gift card or discount.

Bioinformatics

Gene Symbol C21ORF33