C20orf7 Antibody

Images

 
Immunohistochemistry-Paraffin: C20orf7 Antibody [NBP2-14400] Staining of human nasopharynx shows strong membranous positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C20orf7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VNDLPRALEQIHYILKPDGVFIGAMFGGDTLYELRCSLQLAETEREGGFS PHISPFTAVNDLGHLLGRAGFNTLTVDTDEIQVNYPGMFELMED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDUFAF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C20orf7 Protein (NBP2-14400PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C20orf7 Antibody

  • bA526K24.2
  • C20orf7
  • chromosome 20 open reading frame 7
  • dJ842G6.1
  • EC 2.1.1
  • EC 2.1.1.-
  • FLJ22324
  • MGC90272
  • NADH dehydrogenase (ubiquinone) complex I, assembly factor 5
  • probable methyltransferase C20orf7, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27464
Species: Hu
Applications: WB, PEP-ELISA
NBP1-84503
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14585
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24567
Species: Hu
Applications: WB
NBP2-47359
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004535-Q01
Species: Hu
NBP1-89382
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-88929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00004704-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92171
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
H00004722-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-46127
Species: Hu
Applications: WB, IHC
NBP2-14400
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for C20orf7 Antibody (NBP2-14400) (0)

There are no publications for C20orf7 Antibody (NBP2-14400).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C20orf7 Antibody (NBP2-14400) (0)

There are no reviews for C20orf7 Antibody (NBP2-14400). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C20orf7 Antibody (NBP2-14400) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C20orf7 Products

Bioinformatics Tool for C20orf7 Antibody (NBP2-14400)

Discover related pathways, diseases and genes to C20orf7 Antibody (NBP2-14400). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C20orf7 Antibody (NBP2-14400)

Discover more about diseases related to C20orf7 Antibody (NBP2-14400).
 

Pathways for C20orf7 Antibody (NBP2-14400)

View related products by pathway.

PTMs for C20orf7 Antibody (NBP2-14400)

Learn more about PTMs related to C20orf7 Antibody (NBP2-14400).

Blogs on C20orf7

There are no specific blogs for C20orf7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C20orf7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDUFAF5