C20orf4 Antibody

Images

 
Western Blot: C20orf4 Antibody [NBP2-30422] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: CACO-2
Immunocytochemistry/ Immunofluorescence: C20orf4 Antibody [NBP2-30422] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
Immunohistochemistry: C20orf4 Antibody [NBP2-30422] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C20orf4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AAR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C20orf4 Protein (NBP2-30422PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C20orf4 Antibody

  • AAR2 splicing factor homolog (S. cerevisiae)
  • bA234K24.2
  • C20orf4
  • CGI-23
  • chromosome 20 open reading frame 4
  • DKFZp564N1363
  • hypothetical protein LOC25980

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20228
Species: Hu, Ze
Applications: WB
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-90086
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55120
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
AF745
Species: Mu
Applications: WB, Block
NB100-2070
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-586
Species: Hu
Applications: WB, IP
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56740
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-83565
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for C20orf4 Antibody (NBP2-30422) (0)

There are no publications for C20orf4 Antibody (NBP2-30422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C20orf4 Antibody (NBP2-30422) (0)

There are no reviews for C20orf4 Antibody (NBP2-30422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C20orf4 Antibody (NBP2-30422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C20orf4 Products

Bioinformatics Tool for C20orf4 Antibody (NBP2-30422)

Discover related pathways, diseases and genes to C20orf4 Antibody (NBP2-30422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C20orf4 Antibody (NBP2-30422)

Discover more about diseases related to C20orf4 Antibody (NBP2-30422).
 

Pathways for C20orf4 Antibody (NBP2-30422)

View related products by pathway.

PTMs for C20orf4 Antibody (NBP2-30422)

Learn more about PTMs related to C20orf4 Antibody (NBP2-30422).

Blogs on C20orf4

There are no specific blogs for C20orf4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C20orf4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AAR2
Uniprot