C20orf111 Antibody

Images

 
Western Blot: C20orf111 Antibody [NBP1-91725] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: C20orf111 Antibody [NBP1-91725] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & nuclear speckles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: C20orf111 Antibody [NBP1-91725] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C20orf111 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GKPCTCIGKECQCKRWHDMEVYSFSGLQSVPPLAPERRSTLEDYSQSLHARTLSGSPRSCSEQARVFVDDVTIEDLSGYMEYYLYIPKKMS
Specificity
Specificity of human C20orf111 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C20ORF111
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C20orf111 Protein (NBP1-91725PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C20orf111 Antibody

  • chromosome 20 open reading frame 111
  • dJ1183I21.1
  • HSPC207
  • Osr1
  • oxidative stress responsive 1
  • Perit1
  • peroxide-inducible transcript 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: IHC, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-75623
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80993
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56333
Species: Hu
Applications: WB, ICC/IF
NBP1-03340
Species: Hu
Applications: WB, IP
H00005076-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
H00010736-M01
Species: Hu, Mu
Applications: WB, ELISA, RNAi, RNAi SP
NBP2-15658
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86892
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82874
Species: Hu
Applications: IHC, IHC-P
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for C20orf111 Antibody (NBP1-91725) (0)

There are no publications for C20orf111 Antibody (NBP1-91725).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C20orf111 Antibody (NBP1-91725) (0)

There are no reviews for C20orf111 Antibody (NBP1-91725). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C20orf111 Antibody (NBP1-91725) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for C20orf111 Antibody (NBP1-91725)

Discover related pathways, diseases and genes to C20orf111 Antibody (NBP1-91725). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C20orf111

There are no specific blogs for C20orf111, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C20orf111 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C20ORF111