C1q R1/CD93 Recombinant Protein Antigen

Images

 
There are currently no images for C1q R1/CD93 Protein (NBP1-88316PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

C1q R1/CD93 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD93.

Source: E.coli

Amino Acid Sequence: HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD93
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-88316.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for C1q R1/CD93 Recombinant Protein Antigen

  • AA4 Antigen
  • C1q R1
  • C1q receptor 1
  • C1q Rp
  • C1q/MBL/SPA receptor
  • C1qR(P)
  • C1qR1
  • C1qRp
  • CD93 antigenC1qR
  • CD93 molecule
  • CD93
  • CDw93C1QR1
  • Collectin Receptor
  • Complement component 1 q subcomponent receptor 1
  • complement component 1, q subcomponent, receptor 1
  • complement component C1q receptor
  • dJ737E23.1
  • ECSM3
  • Ly68
  • Matrix-remodeling-associated protein 4
  • matrix-remodelling associated 4
  • MXRA4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-74988
Species: Rt
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, DB, EM, ICC/IF, IHC, IHC-P, IP, PA, B/N
NBP1-22568
Species: Hu
Applications: IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
AF1730
Species: Hu
Applications: Flow, AdBlk, CyTOF-ready, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
MAB3811
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
MAB6979
Species: Hu
Applications: WB
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-88316PEP
Species: Hu
Applications: AC

Publications for C1q R1/CD93 Protein (NBP1-88316PEP) (0)

There are no publications for C1q R1/CD93 Protein (NBP1-88316PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1q R1/CD93 Protein (NBP1-88316PEP) (0)

There are no reviews for C1q R1/CD93 Protein (NBP1-88316PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for C1q R1/CD93 Protein (NBP1-88316PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for C1q R1/CD93 Protein (NBP1-88316PEP)

Discover related pathways, diseases and genes to C1q R1/CD93 Protein (NBP1-88316PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1q R1/CD93 Protein (NBP1-88316PEP)

Discover more about diseases related to C1q R1/CD93 Protein (NBP1-88316PEP).
 

Pathways for C1q R1/CD93 Protein (NBP1-88316PEP)

View related products by pathway.

PTMs for C1q R1/CD93 Protein (NBP1-88316PEP)

Learn more about PTMs related to C1q R1/CD93 Protein (NBP1-88316PEP).

Blogs on C1q R1/CD93

There are no specific blogs for C1q R1/CD93, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our C1q R1/CD93 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD93