C1q R1/CD93 Antibody

Images

 
Western Blot: C1q R1/CD93 Antibody [NBP1-88316] - Analysis in control (vector only transfected HEK293T lysate) and cD93 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: C1q R1/CD93 Antibody [NBP1-88316] - Staining of human spleen shows distinct positivity in endothelial cells and in a subset of red pulp cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1q R1/CD93 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD93
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C1q R1/CD93 Protein (NBP1-88316PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1q R1/CD93 Antibody

  • AA4 Antigen
  • C1q R1
  • C1q receptor 1
  • C1q Rp
  • C1q/MBL/SPA receptor
  • C1qR(P)
  • C1qR1
  • C1qRp
  • CD93 antigenC1qR
  • CD93 molecule
  • CD93
  • CDw93C1QR1
  • Collectin Receptor
  • Complement component 1 q subcomponent receptor 1
  • complement component 1, q subcomponent, receptor 1
  • complement component C1q receptor
  • dJ737E23.1
  • ECSM3
  • Ly68
  • Matrix-remodeling-associated protein 4
  • matrix-remodelling associated 4
  • MXRA4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000712-P01
Species: Hu
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP1-22568
Species: Hu
Applications: IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
MAB381
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NBP2-42213
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NB500-328
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-88316
Species: Hu
Applications: WB, IHC, IHC-P

Publications for C1q R1/CD93 Antibody (NBP1-88316) (0)

There are no publications for C1q R1/CD93 Antibody (NBP1-88316).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1q R1/CD93 Antibody (NBP1-88316) (0)

There are no reviews for C1q R1/CD93 Antibody (NBP1-88316). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1q R1/CD93 Antibody (NBP1-88316) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1q R1/CD93 Products

Bioinformatics Tool for C1q R1/CD93 Antibody (NBP1-88316)

Discover related pathways, diseases and genes to C1q R1/CD93 Antibody (NBP1-88316). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1q R1/CD93 Antibody (NBP1-88316)

Discover more about diseases related to C1q R1/CD93 Antibody (NBP1-88316).
 

Pathways for C1q R1/CD93 Antibody (NBP1-88316)

View related products by pathway.

PTMs for C1q R1/CD93 Antibody (NBP1-88316)

Learn more about PTMs related to C1q R1/CD93 Antibody (NBP1-88316).

Blogs on C1q R1/CD93

There are no specific blogs for C1q R1/CD93, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1q R1/CD93 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD93
Entrez