C1orf69 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C1orf69 Antibody [NBP2-55157] - Staining of human cell line CACO-2 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1orf69 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AGYAHFLNVQGRTLYDVILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAGAAAILIRD
Specificity
Specificity of human C1orf69 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IBA57
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C1orf69 Recombinant Protein Antigen (NBP2-55157PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for C1orf69 Antibody

  • C1orf69
  • FLJ12734
  • FLJ13849
  • IBA57, iron-sulfur cluster assembly homolog (S. cerevisiae)
  • iron-sulfur cluster assembly factor for biotin synthase- and aconitase-like mitochondrial proteins, with a mass of 57kDa
  • mitochondrial
  • putative transferase C1orf69, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89716
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33413
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NBL1-17022
Species: Hu
NBP1-84533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76701
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89313
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000212-M01
Species: Hu, Mu
Applications: WB, ELISA
H00006583-A01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-FrFl, IHC-WhMt
NBP2-56992
Species: Hu
Applications: IHC, IHC-P
NBP2-65594
Species: Hu
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-82845
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46161
Species: Hu
Applications: WB, IHC
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for C1orf69 Antibody (NBP2-55157) (0)

There are no publications for C1orf69 Antibody (NBP2-55157).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1orf69 Antibody (NBP2-55157) (0)

There are no reviews for C1orf69 Antibody (NBP2-55157). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C1orf69 Antibody (NBP2-55157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for C1orf69 Antibody (NBP2-55157)

Discover related pathways, diseases and genes to C1orf69 Antibody (NBP2-55157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for C1orf69 Antibody (NBP2-55157)

View related products by pathway.

Blogs on C1orf69

There are no specific blogs for C1orf69, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1orf69 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IBA57