C1orf64 Antibody


Western Blot: C1orf64 Antibody [NBP1-81157] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunocytochemistry/ Immunofluorescence: C1orf64 Antibody [NBP1-81157] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: C1orf64 Antibody [NBP1-81157] - Staining of human breast shows weak nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: C1orf64 Antibody [NBP1-81157] - Staining of human tonsil shows strong positivity in a subset of lymphoid cells outside reaction centra.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

C1orf64 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:HLTRVTPMGGGCLAQARATLPLCRGSVASASFPVSPLCPQEVPEAKGKPVKAAPVRSSTWGTVKDSLKALSSCVCGQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
C1orf64 Protein (NBP1-81157PEP)
Read Publication using NBP1-81157.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22341523)

Alternate Names for C1orf64 Antibody

  • chromosome 1 open reading frame 64
  • ERRF
  • MGC24047
  • putative uncharacterized protein C1orf64
  • RP11-5P18.4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Bv, Ch, GP, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, PA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western

Publications for C1orf64 Antibody (NBP1-81157)(1)

Reviews for C1orf64 Antibody (NBP1-81157) (0)

There are no reviews for C1orf64 Antibody (NBP1-81157). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C1orf64 Antibody (NBP1-81157) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C1orf64 Antibody Products

Related Products by Gene

Bioinformatics Tool for C1orf64 Antibody (NBP1-81157)

Discover related pathways, diseases and genes to C1orf64 Antibody (NBP1-81157). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1orf64 Antibody (NBP1-81157)

Discover more about diseases related to C1orf64 Antibody (NBP1-81157).

Pathways for C1orf64 Antibody (NBP1-81157)

View related products by pathway.

Blogs on C1orf64

There are no specific blogs for C1orf64, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol C1ORF64

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-81157 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought