C1orf124 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C1orf124 Antibody [NBP1-84163] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: C1orf124 Antibody [NBP1-84163] - Staining of human cerebellum shows distinct cytoplasmic positivity in purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1orf124 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPRTN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C1orf124 Protein (NBP1-84163PEP)
Publications
Read Publications using NBP1-84163.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1orf124 Antibody

  • C1orf124
  • chromosome 1 open reading frame 124
  • DDDL1880
  • dJ876B10.3
  • DKFZP547N043
  • PRO4323
  • RP5-876B10.3
  • Spartan
  • SprT-like N-terminal domain
  • zinc finger RAD18 domain-containing protein C1orf124

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00056852-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-00990
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40591
Species: Hu
Applications: WB, IHC-P, IP
NBP1-88680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14147
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF163
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46522
Species: Hu
Applications: WB, IHC
AF8408
Species: Hu
Applications: WB
H00010714-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
H00010721-M09
Species: Hu
Applications: WB, ELISA
NBP1-84163
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for C1orf124 Antibody (NBP1-84163)(2)

Reviews for C1orf124 Antibody (NBP1-84163) (0)

There are no reviews for C1orf124 Antibody (NBP1-84163). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C1orf124 Antibody (NBP1-84163) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1orf124 Products

Bioinformatics Tool for C1orf124 Antibody (NBP1-84163)

Discover related pathways, diseases and genes to C1orf124 Antibody (NBP1-84163). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C1orf124

There are no specific blogs for C1orf124, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1orf124 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPRTN