C15orf58 Antibody

Images

 
Immunohistochemistry-Paraffin: C15orf58 Antibody [NBP2-14379] - Staining of human lateral ventricle shows strong cytoplasmic positivity in neuronal and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C15orf58 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: IAHNLFVTRGAPPGKTSPSSALTGVRVILWARKSSFGIKDGEAFNVALCE LAGHLPVKTSQDFSSLTEAAAVALIQDCRL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDPGP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C15orf58 Protein (NBP2-14379PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C15orf58 Antibody

  • C15orf58
  • chromosome 15 open reading frame 58
  • GDP-D-glucose phosphorylase 1
  • GDP-D-glucose phosphorylase C15orf58
  • VTC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-07799
Species: Hu
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-84463
Species: Hu
Applications: IHC, IHC-P
NBP1-31333
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93521
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7550
Species: Hu
Applications: WB
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NB110-61576
Species: Hu, Mu, Rt, Po, Ca
Applications: WB, ICC/IF, IHC-P
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for C15orf58 Antibody (NBP2-14379) (0)

There are no publications for C15orf58 Antibody (NBP2-14379).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C15orf58 Antibody (NBP2-14379) (0)

There are no reviews for C15orf58 Antibody (NBP2-14379). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C15orf58 Antibody (NBP2-14379) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C15orf58 Products

Bioinformatics Tool for C15orf58 Antibody (NBP2-14379)

Discover related pathways, diseases and genes to C15orf58 Antibody (NBP2-14379). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C15orf58

There are no specific blogs for C15orf58, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C15orf58 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDPGP1