C15orf54 Antibody


Immunohistochemistry: C15orf54 Antibody [NBP2-30734] - Staining of human tonsil shows moderate nuclear positivity in subsets of germinal center cells.

Product Details

Product Discontinued
View other related C15orf54 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C15orf54 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MEVKFITGKHGGRRPQRAEPQRICRALWLT
Specificity of human C15orf54 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C15orf54 Antibody

  • Chromosome 15 Open Reading Frame 54
  • Putative Uncharacterized Protein C15orf54


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C15orf54 Antibody (NBP2-30734) (0)

There are no publications for C15orf54 Antibody (NBP2-30734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C15orf54 Antibody (NBP2-30734) (0)

There are no reviews for C15orf54 Antibody (NBP2-30734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for C15orf54 Antibody (NBP2-30734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Bioinformatics Tool for C15orf54 Antibody (NBP2-30734)

Discover related pathways, diseases and genes to C15orf54 Antibody (NBP2-30734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C15orf54

There are no specific blogs for C15orf54, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C15orf54 Antibody and receive a gift card or discount.


Gene Symbol C15orf54