Recombinant Human C12orf57 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human C12orf57 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 126 of Human GRCC10 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYGFSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
C12ORF57
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human C12orf57 Protein

  • C10
  • C10GRCC10
  • chromosome 12 open reading frame 57
  • GRCC10
  • likely ortholog of mouse gene rich cluster, C10
  • protein C10

Background

GRCC10( AAH09925, 1 a.a. - 127 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-09016
Species: Hu
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-63270
Species: Hu
Applications: WB, ELISA
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
H00113246-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for C12orf57 Recombinant Protein (H00113246-P01) (0)

There are no publications for C12orf57 Recombinant Protein (H00113246-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf57 Recombinant Protein (H00113246-P01) (0)

There are no reviews for C12orf57 Recombinant Protein (H00113246-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C12orf57 Recombinant Protein (H00113246-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional C12orf57 Products

Bioinformatics Tool for C12orf57 Recombinant Protein (H00113246-P01)

Discover related pathways, diseases and genes to C12orf57 Recombinant Protein (H00113246-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C12orf57

There are no specific blogs for C12orf57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human C12orf57 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF57