C12orf57 Antibody

Images

 
Immunohistochemistry-Paraffin: C12orf57 Antibody [NBP2-31752] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C12orf57 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12ORF57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C12orf57 Protein (NBP2-31752PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C12orf57 Antibody

  • C10
  • C10GRCC10
  • chromosome 12 open reading frame 57
  • GRCC10
  • likely ortholog of mouse gene rich cluster, C10
  • protein C10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30078
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-09016
Species: Hu
MAB8126
Species: Hu
Applications: WB, Simple Western
MAB6529
Species: Hu
Applications: WB, Simple Western
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-63270
Species: Hu
Applications: WB, ELISA
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80815
Species: Hu
Applications: WB, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31752
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for C12orf57 Antibody (NBP2-31752) (0)

There are no publications for C12orf57 Antibody (NBP2-31752).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf57 Antibody (NBP2-31752) (0)

There are no reviews for C12orf57 Antibody (NBP2-31752). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C12orf57 Antibody (NBP2-31752) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C12orf57 Products

Bioinformatics Tool for C12orf57 Antibody (NBP2-31752)

Discover related pathways, diseases and genes to C12orf57 Antibody (NBP2-31752). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C12orf57

There are no specific blogs for C12orf57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C12orf57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF57
Uniprot