C12orf42 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: C12orf42 Antibody [NBP1-83566] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: C12orf42 Antibody [NBP1-83566] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine pancreas.

Product Details

Summary
Product Discontinued
View other related C12orf42 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83566
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C12orf42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ERTQNSMACKRLLHTCQYIVPRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPKQAWNSSFLEQLVKKPNWAHSVNPVHLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C12ORF42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C12orf42 Antibody

  • chromosome 12 open reading frame 42
  • FLJ25323
  • hypothetical protein LOC374470
  • MGC57409

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C12orf42 Antibody (NBP1-83566) (0)

There are no publications for C12orf42 Antibody (NBP1-83566).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C12orf42 Antibody (NBP1-83566) (0)

There are no reviews for C12orf42 Antibody (NBP1-83566). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for C12orf42 Antibody (NBP1-83566) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C12orf42 Products

C12orf42 NBP1-83566

Bioinformatics Tool for C12orf42 Antibody (NBP1-83566)

Discover related pathways, diseases and genes to C12orf42 Antibody (NBP1-83566). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C12orf42 Antibody (NBP1-83566)

Discover more about diseases related to C12orf42 Antibody (NBP1-83566).
 

Pathways for C12orf42 Antibody (NBP1-83566)

View related products by pathway.

Blogs on C12orf42

There are no specific blogs for C12orf42, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C12orf42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C12ORF42