C11orf92 Antibody

Images

 
Immunohistochemistry: C11orf92 Antibody [NBP1-93743] - Staining of human kidney shows strong granular cytoplasmic positivity in cells of tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf92 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ESCSVAQAGVLTSPFMWRWTGMAGALSALDNTIEDDADDQLPCGEGRPGWVRGELLGSQGVCKDSKDLFVPT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF92
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Human. Predicted cross-reactivity based on sequence identity: Mouse (28%) and Rat (26%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf92 Antibody

  • chromosome 11 open reading frame 92
  • DKFZp781P19126
  • FLJ45803

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13448
Species: Hu
Applications: IHC, IHC-P
NBP2-42387
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-11832
Species: Hu
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65125
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP1-87877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-56423
Species: Hu
Applications: ICC/IF
NBP1-86092
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01438
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready

Publications for C11orf92 Antibody (NBP1-93743) (0)

There are no publications for C11orf92 Antibody (NBP1-93743).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf92 Antibody (NBP1-93743) (0)

There are no reviews for C11orf92 Antibody (NBP1-93743). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for C11orf92 Antibody (NBP1-93743) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C11orf92 Products

C11orf92 NBP1-93743

Bioinformatics Tool for C11orf92 Antibody (NBP1-93743)

Discover related pathways, diseases and genes to C11orf92 Antibody (NBP1-93743). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C11orf92 Antibody (NBP1-93743)

Discover more about diseases related to C11orf92 Antibody (NBP1-93743).
 

Pathways for C11orf92 Antibody (NBP1-93743)

View related products by pathway.

Blogs on C11orf92

There are no specific blogs for C11orf92, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf92 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF92
Entrez
Uniprot