C11orf57 Antibody

Images

 
Western Blot: C11orf57 Antibody [NBP1-84606] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: C11orf57 Antibody [NBP1-84606] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: C11orf57 Antibody [NBP1-84606] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf57 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SGTLEDDFLKAKSWNKKFYDYEANMPDRWGHSGYKELYPEEFETDSSDQQDITNGKKTSPQVKSSTHESRKHKKSKKSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C11ORF57
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C11orf57 Protein (NBP1-84606PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf57 Antibody

  • chromosome 11 open reading frame 57
  • FLJ10726
  • hypothetical protein LOC55216

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92372
Species: Hu
Applications: IHC, IHC-P
H00026521-M15
Species: Hu
Applications: WB, ELISA
NBP1-87069
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-03656
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34065
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00006391-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-45978
Species: Hu
Applications: WB, Flow, IHC
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for C11orf57 Antibody (NBP1-84606) (0)

There are no publications for C11orf57 Antibody (NBP1-84606).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf57 Antibody (NBP1-84606) (0)

There are no reviews for C11orf57 Antibody (NBP1-84606). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C11orf57 Antibody (NBP1-84606) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C11orf57 Products

Bioinformatics Tool for C11orf57 Antibody (NBP1-84606)

Discover related pathways, diseases and genes to C11orf57 Antibody (NBP1-84606). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C11orf57 Antibody (NBP1-84606)

Discover more about diseases related to C11orf57 Antibody (NBP1-84606).

Blogs on C11orf57

There are no specific blogs for C11orf57, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf57 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C11ORF57