C11orf51 Antibody

Images

 
Western Blot: C11orf51 Antibody [NBP1-84151] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: C11orf51 Antibody [NBP1-84151] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: C11orf51 Antibody [NBP1-84151] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf51 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEED
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANAPC15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C11orf51 Protein (NBP1-84151PEP)
Publications
Read Publication using NBP1-84151.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf51 Antibody

  • anaphase promoting complex subunit 15
  • APC15
  • C11orf51
  • chromosome 11 open reading frame 51
  • DKFZP564M082
  • HSPC020
  • hypothetical protein LOC25906

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
AF4185
Species: Hu
Applications: ICC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31541
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-15840
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-77155
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-86217
Species: Hu
Applications: IHC, IHC-P
NBP1-85885
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for C11orf51 Antibody (NBP1-84151)(1)

Reviews for C11orf51 Antibody (NBP1-84151) (0)

There are no reviews for C11orf51 Antibody (NBP1-84151). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C11orf51 Antibody (NBP1-84151) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C11orf51 Products

Bioinformatics Tool for C11orf51 Antibody (NBP1-84151)

Discover related pathways, diseases and genes to C11orf51 Antibody (NBP1-84151). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C11orf51

There are no specific blogs for C11orf51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANAPC15