C11orf46 Antibody

Images

 
Western Blot: C11orf46 Antibody [NBP2-48890] - Analysis in control (vector only transfected HEK293T lysate) and ARL14EP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: C11orf46 Antibody [NBP2-48890] - Staining of human lateral ventricle shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C11orf46 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FSGMDLCDCLDEDCLGCFYACPACGSTKCGAECRCDRKWLYEQIEIEGGEIIHNKHA
Specificity
Specificity of human C11orf46 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL14EP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C11orf46 Recombinant Protein Antigen (NBP2-48890PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C11orf46 Antibody

  • ADP-ribosylation factor-like 14 effector protein
  • ARF7EP
  • C11orf46
  • chromosome 11 open reading frame 46
  • dJ299F11.1
  • FLJ38968
  • hypothetical protein LOC120534

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32606
Species: Mu
Applications: IHC, IHC-P
NBP1-89689
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2705
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NBP2-48890
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for C11orf46 Antibody (NBP2-48890) (0)

There are no publications for C11orf46 Antibody (NBP2-48890).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf46 Antibody (NBP2-48890) (0)

There are no reviews for C11orf46 Antibody (NBP2-48890). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C11orf46 Antibody (NBP2-48890) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for C11orf46 Antibody (NBP2-48890)

Discover related pathways, diseases and genes to C11orf46 Antibody (NBP2-48890). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C11orf46

There are no specific blogs for C11orf46, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C11orf46 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL14EP