C11orf35 Antibody


Western Blot: C11orf35 Antibody [NBP2-31720] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry: C11orf35 Antibody [NBP2-31720] - Liver cancer
Immunohistochemistry: C11orf35 Antibody [NBP2-31720] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and Leydig cells.
Immunohistochemistry: C11orf35 Antibody [NBP2-31720] - Liver

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

C11orf35 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PETPTCLPDTTPHPAPVVCSADPQLALESLDPRTLRLLWRQRELEIQALRWAIQNGEDARLCHILEEVAGLPPKRSS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:250 - 1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
C11orf35 Protein (NBP2-31720PEP)

Alternate Names for C11orf35 Antibody

  • uncharacterized protein C11orf35
  • chromosome 11 open reading frame 35


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C11orf35 Antibody (NBP2-31720) (0)

There are no publications for C11orf35 Antibody (NBP2-31720).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C11orf35 Antibody (NBP2-31720) (0)

There are no reviews for C11orf35 Antibody (NBP2-31720). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C11orf35 Antibody (NBP2-31720) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C11orf35 Antibody Products

Bioinformatics Tool for C11orf35 Antibody (NBP2-31720)

Discover related pathways, diseases and genes to C11orf35 Antibody (NBP2-31720). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for C11orf35 Antibody (NBP2-31720)

Find related products by research area.

Blogs on C11orf35

There are no specific blogs for C11orf35, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol C11ORF35

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-31720 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought