C10orf91 Antibody


Western Blot: C10orf91 Antibody [NBP1-90790] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry: C10orf91 Antibody [NBP1-90790] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Immunofluorescence: C10orf91 Antibody [NBP1-90790] - Staining human cell line A549 shows positivity in nucleus but excluded from the nucleoli. Antibody staining is shown in green.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

C10orf91 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MWSFLPGAESVSMGPVPGVSSLGACWTHDQDSGRAEDRPQAPRITQYTWVLSFLFTEKPQTRSTSPISHQGQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
C10orf91 Protein (NBP1-90790PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for C10orf91 Antibody

  • bA432J24.4
  • chromosome 10 open reading frame 91
  • RP11-432J24.4


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for C10orf91 Antibody (NBP1-90790) (0)

There are no publications for C10orf91 Antibody (NBP1-90790).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C10orf91 Antibody (NBP1-90790) (0)

There are no reviews for C10orf91 Antibody (NBP1-90790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for C10orf91 Antibody (NBP1-90790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional C10orf91 Products

C10orf91 NBP1-90790

Bioinformatics Tool for C10orf91 Antibody (NBP1-90790)

Discover related pathways, diseases and genes to C10orf91 Antibody (NBP1-90790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on C10orf91

There are no specific blogs for C10orf91, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our C10orf91 Antibody and receive a gift card or discount.


Gene Symbol C10ORF91