C-Reactive Protein/CRP Antibody

Images

 
Western Blot: C-Reactive Protein/CRP Antibody [H00001401-B02P] - Analysis of CRP expression in transfected 293T cell line by CRP polyclonal antibody. Lane 1: CRP transfected lysate(10.4 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Product Discontinued
View other related C-Reactive Protein/CRP Primary Antibodies

Order Details


    • Catalog Number
      H00001401-B02P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

C-Reactive Protein/CRP Antibody Summary

Immunogen
CRP (ENSP00000357093, 1 a.a. - 91 a.a.) full-length human protein. MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGPNVLNWRALKYEVQGEVFTKPQLWP
Clonality
Polyclonal
Host
Mouse
Gene
CRP
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C-Reactive Protein/CRP Antibody

  • C-Reactive Protein
  • C-reactive protein, pentraxin-related
  • CRP
  • MGC88244
  • pentraxin 1
  • PTX1MGC149895

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
AF4409
Species: Mu
Applications: WB
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2558
Species: Hu, Mu
Applications: WB, Simple Western

Publications for C-Reactive Protein/CRP Antibody (H00001401-B02P) (0)

There are no publications for C-Reactive Protein/CRP Antibody (H00001401-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C-Reactive Protein/CRP Antibody (H00001401-B02P) (0)

There are no reviews for C-Reactive Protein/CRP Antibody (H00001401-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C-Reactive Protein/CRP Antibody (H00001401-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C-Reactive Protein/CRP Products

Bioinformatics Tool for C-Reactive Protein/CRP Antibody (H00001401-B02P)

Discover related pathways, diseases and genes to C-Reactive Protein/CRP Antibody (H00001401-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C-Reactive Protein/CRP Antibody (H00001401-B02P)

Discover more about diseases related to C-Reactive Protein/CRP Antibody (H00001401-B02P).
 

Pathways for C-Reactive Protein/CRP Antibody (H00001401-B02P)

View related products by pathway.

PTMs for C-Reactive Protein/CRP Antibody (H00001401-B02P)

Learn more about PTMs related to C-Reactive Protein/CRP Antibody (H00001401-B02P).
 

Research Areas for C-Reactive Protein/CRP Antibody (H00001401-B02P)

Find related products by research area.

Blogs on C-Reactive Protein/CRP

There are no specific blogs for C-Reactive Protein/CRP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C-Reactive Protein/CRP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CRP
Entrez
Uniprot