c-Maf Antibody (6B8)

Images

 
Western Blot: c-Maf Antibody (6B8) [H00004094-M02] - MAF monoclonal antibody (M02), clone 6B8. Analysis of MAF expression in PC-12.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
6B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

c-Maf Antibody (6B8) Summary

Immunogen
MAF (NP_005351 304 a.a. - 403 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWKPQHRVLTSVFTK
Specificity
MAF - v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian) (6B8)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00004094-M02.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for c-Maf Antibody (6B8)

  • Avian musculoaponeurotic fibrosarcoma (MAF) protooncogene
  • CCA4
  • c-maf proto-oncogene
  • cMaf
  • c-Maf
  • MAF2
  • MGC71685
  • Proto-oncogene c-Maf
  • T lymphocyte c-maf long form
  • transcription factor Maf
  • v-maf musculoaponeurotic fibrosarcoma (avian) oncogene homolog
  • v-maf musculoaponeurotic fibrosarcoma oncogene homolog (avian)
  • V-maf musculoaponeurotic fibrosarcoma oncogene homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-43299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
MAB3809
Species: Hu, Mu
Applications: WB
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP

Publications for c-Maf Antibody (H00004094-M02)(1)

Reviews for c-Maf Antibody (H00004094-M02) (0)

There are no reviews for c-Maf Antibody (H00004094-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for c-Maf Antibody (H00004094-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional c-Maf Products

Bioinformatics Tool for c-Maf Antibody (H00004094-M02)

Discover related pathways, diseases and genes to c-Maf Antibody (H00004094-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for c-Maf Antibody (H00004094-M02)

Discover more about diseases related to c-Maf Antibody (H00004094-M02).
 

Pathways for c-Maf Antibody (H00004094-M02)

View related products by pathway.

PTMs for c-Maf Antibody (H00004094-M02)

Learn more about PTMs related to c-Maf Antibody (H00004094-M02).

Blogs on c-Maf

There are no specific blogs for c-Maf, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our c-Maf Antibody (6B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAF
Entrez
Uniprot