Recombinant Human BTN1A1/Butyrophilin Protein

Images

 

Product Details

Summary
Product Discontinued
View other related BTN1A1/Butyrophilin Peptides and Proteins

Order Details


    • Catalog Number
      H00000696-Q03
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human BTN1A1/Butyrophilin Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-100 of Human BTN1A1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VALRIRGVRVSDDGEYTCFFREDGSYEEALVHLKVAALGSDPHISMQVQENGEICLECTSVGWYPEPQVQWRTSKGEKFPSTSESRNPDEEGLFTVAASV

Protein/Peptide Type
Partial Recombinant Protein
Gene
BTN1A1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BTN1A1/Butyrophilin Protein

  • BTBTNbK14H9.2 (butyrophilin, subfamily 1, member A1)
  • BTN
  • BTN1A1
  • butyrophilin subfamily 1 member A1
  • butyrophilin, subfamily 1, member A1

Background

Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP2-07799
Species: Hu
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
H00000696-Q03
Species: Hu
Applications: WB, ELISA, PA

Publications for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03) (0)

There are no publications for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03) (0)

There are no reviews for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BTN1A1/Butyrophilin Products

Bioinformatics Tool for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03)

Discover related pathways, diseases and genes to BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03)

Discover more about diseases related to BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03).
 

Pathways for BTN1A1/Butyrophilin Partial Recombinant Protein (H00000696-Q03)

View related products by pathway.

Blogs on BTN1A1/Butyrophilin

There are no specific blogs for BTN1A1/Butyrophilin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BTN1A1/Butyrophilin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BTN1A1
Entrez