BTLA/CD272 Antibody

Images

 
Immunohistochemistry-Paraffin: BTLA/CD272 Antibody [NBP2-14366] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

Product Details

Summary
Product Discontinued
View other related BTLA/CD272 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-14366
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BTLA/CD272 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCV KLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTT LYVTDVKSASERPSKDEMASRP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTLA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTLA/CD272 Antibody

  • B and T lymphocyte associated
  • B and T lymphocyte attenuator
  • B- and T-lymphocyte attenuator
  • B- and T-lymphocyte-associated protein
  • BTLA
  • BTLA1
  • CD272 antigen
  • CD272
  • FLJ16065
  • MGC129743

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF1086
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB7158
Species: Hu, Mu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-12499
Species: Hu
Applications: IHC, IHC-P
MAB6700
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-30536
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-2421
Species: Hu
Applications: WB, Flow, IHC, IHC-P, PEP-ELISA
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
NBP2-14366
Species: Hu
Applications: IHC, IHC-P

Publications for BTLA/CD272 Antibody (NBP2-14366) (0)

There are no publications for BTLA/CD272 Antibody (NBP2-14366).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTLA/CD272 Antibody (NBP2-14366) (0)

There are no reviews for BTLA/CD272 Antibody (NBP2-14366). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BTLA/CD272 Antibody (NBP2-14366) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTLA/CD272 Products

Bioinformatics Tool for BTLA/CD272 Antibody (NBP2-14366)

Discover related pathways, diseases and genes to BTLA/CD272 Antibody (NBP2-14366). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTLA/CD272 Antibody (NBP2-14366)

Discover more about diseases related to BTLA/CD272 Antibody (NBP2-14366).
 

Pathways for BTLA/CD272 Antibody (NBP2-14366)

View related products by pathway.

PTMs for BTLA/CD272 Antibody (NBP2-14366)

Learn more about PTMs related to BTLA/CD272 Antibody (NBP2-14366).

Blogs on BTLA/CD272

There are no specific blogs for BTLA/CD272, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTLA/CD272 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTLA
Entrez