BRMS1L Antibody


Western Blot: BRMS1L Antibody [NBP1-74077] - ACHN Cell Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related BRMS1L Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BRMS1L Antibody Summary

Synthetic peptides corresponding to the C terminal of BRMS1L. Immunizing peptide sequence GQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSKLYISQLQKGKYSI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against BRMS1L and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BRMS1L Antibody

  • breast cancer metastasis-suppressor 1
  • breast cancer metastasis-suppressor 1-like protein
  • breast cancer metastasis-suppressor 1-like
  • BRMS1
  • BRMS1-homolog protein p40
  • BRMS1-like protein p40
  • FLJ39177
  • MGC11296


The protein encoded by this gene shows sequence similarity to the human breast carcinoma metastasis suppressor (BRMS1) protein and the mammalian Sds3 (suppressor of defective silencing 3) proteins. This protein is a component of the mSin3a family of histone deacetylase complexes (HDAC).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Pm
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, IHC, ICC

Publications for BRMS1L Antibody (NBP1-74077) (0)

There are no publications for BRMS1L Antibody (NBP1-74077).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRMS1L Antibody (NBP1-74077) (0)

There are no reviews for BRMS1L Antibody (NBP1-74077). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRMS1L Antibody (NBP1-74077) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRMS1L Products

Bioinformatics Tool for BRMS1L Antibody (NBP1-74077)

Discover related pathways, diseases and genes to BRMS1L Antibody (NBP1-74077). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRMS1L Antibody (NBP1-74077)

Discover more about diseases related to BRMS1L Antibody (NBP1-74077).

Research Areas for BRMS1L Antibody (NBP1-74077)

Find related products by research area.

Blogs on BRMS1L

There are no specific blogs for BRMS1L, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRMS1L Antibody and receive a gift card or discount.


Gene Symbol BRMS1L