Recombinant Human Brevican Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Brevican Peptides and Proteins

Order Details


    • Catalog Number
      H00063827-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Brevican Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 63-162 of Human BCAN partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDVSLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYR

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
BCAN

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Brevican Protein

  • ALPBRE
  • BCAN
  • BEHAB
  • BEHABbrevican core protein
  • Brain-enriched hyaluronan-binding protein
  • Brevican
  • Chondroitin sulfate proteoglycan 7
  • chondroitin sulfate proteoglycan BEHAB
  • chondroitin sulfate proteoglycan BEHAB/brevican
  • CSPG7
  • CSPG7brevican proteoglycan
  • MGC13038

Background

BCAN - brevican

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5800
Species: Mu, Rt
Applications: WB, IHC
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2688
Species: Hu
Applications: WB
AF3865
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP1-91977
Species: Hu
Applications: WB, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57712
Species: Hu
Applications: ICC/IF
AF2608
Species: Hu
Applications: WB
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89020
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89246
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Brevican Partial Recombinant Protein (H00063827-Q01) (0)

There are no publications for Brevican Partial Recombinant Protein (H00063827-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Brevican Partial Recombinant Protein (H00063827-Q01) (0)

There are no reviews for Brevican Partial Recombinant Protein (H00063827-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Brevican Partial Recombinant Protein (H00063827-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Brevican Products

Bioinformatics Tool for Brevican Partial Recombinant Protein (H00063827-Q01)

Discover related pathways, diseases and genes to Brevican Partial Recombinant Protein (H00063827-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Brevican Partial Recombinant Protein (H00063827-Q01)

Discover more about diseases related to Brevican Partial Recombinant Protein (H00063827-Q01).
 

Pathways for Brevican Partial Recombinant Protein (H00063827-Q01)

View related products by pathway.

PTMs for Brevican Partial Recombinant Protein (H00063827-Q01)

Learn more about PTMs related to Brevican Partial Recombinant Protein (H00063827-Q01).

Blogs on Brevican

There are no specific blogs for Brevican, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Brevican Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BCAN
Entrez