BRCA1 Antibody


Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP1-88550] - Staining of human lymph node shows positivity in lymphoid cells.
Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP1-88550] - Staining of human breast shows positivity in glandular cells.
Immunohistochemistry-Paraffin: BRCA1 Antibody [NBP1-88550] - Staining of human testis shows positivity in cells in seminiferous ducts.

Product Details

Product Discontinued
View other related BRCA1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BRCA1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RVHSKSVESNIEDKIFGKTYRKKASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRPTSGLHPEDFIKKADLAV
Specificity of human BRCA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Read Publication using NBP1-88550.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24303032)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for BRCA1 Antibody

  • BRCA1
  • breast and ovarian cancer susceptibility protein 1
  • breast and ovarian cancer sususceptibility protein
  • breast cancer 1, early onset
  • breast cancer type 1 susceptibility protein
  • EC 6.3.2
  • EC 6.3.2.-
  • IRIS
  • PNCA4
  • PSCP
  • subunit 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu, Ha, Ma, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KO
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP

Publications for BRCA1 Antibody (NBP1-88550)(1)

Reviews for BRCA1 Antibody (NBP1-88550) (0)

There are no reviews for BRCA1 Antibody (NBP1-88550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BRCA1 Antibody (NBP1-88550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BRCA1 Products

Bioinformatics Tool for BRCA1 Antibody (NBP1-88550)

Discover related pathways, diseases and genes to BRCA1 Antibody (NBP1-88550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRCA1 Antibody (NBP1-88550)

Discover more about diseases related to BRCA1 Antibody (NBP1-88550).

Pathways for BRCA1 Antibody (NBP1-88550)

View related products by pathway.

PTMs for BRCA1 Antibody (NBP1-88550)

Learn more about PTMs related to BRCA1 Antibody (NBP1-88550).

Research Areas for BRCA1 Antibody (NBP1-88550)

Find related products by research area.

Blogs on BRCA1. Showing 1-10 of 20 blog posts - Show all blog posts.

Autophagy: Pro or Anti-tumorigenic? And the role of epigenetics in this debate
By Christina Towers, PhDAutophagy is an evolutionarily conserved process that cells use to break down damaged cytoplasmic constituents in order to fuel cellular metabolism, particularly in instances of stress. This process has been heavily...  Read full blog post.

Further unraveling the role of gamma H2AX in DNA damage response
Our genome experiences a moderate amount of DNA damage in our cells on a daily basis.  This DNA damage can be in response to external environmental factors, or be a result of our internal metabolic processes going awry.  While normal rates of DNA ...  Read full blog post.

The recent relationship of BRCA1 and 53BP1
The p53-binding protein 1 (53BP1) is a DNA damage response factor, which is recruited to nuclear structures at the site of DNA damage.  DNA double-strand breaks (DSBs) are mutations that are detrimental to cell viability and genome stability, and m...  Read full blog post.

ATM - detecting and responding to DNA damage
Ataxia telangiectasia mutated (ATM) is essential for the maintenance of genomic stability. ATM is a 370 kDa serine-threonine kinase that is constitutively expressed in various tissues. Although primarily nuclear, ATM is also found at lower levels...  Read full blog post.

FANCD2 (Fanconi anemia subunit D2 protein)
Fanconi anemia (FANC) is a rare, autosomal-recessive genetic disorder that is a heterogeneous cancer susceptibility condition that manifests with a wide range of symptoms such as congenital malformations, deteriorating bone marrow failure, DNA-dama...  Read full blog post.

53BP1 - a marker for DNA Double Strand Break
53BP1 (p53 binding protein 1) was originally thought to be an enhancer for p53 transcriptional, but later studies have demonstrated that it is actually a substrate for ataxia telangiectasia mutated (ATM). 53BP1 is a classic late DNA damage response...  Read full blog post.

FANCD2: A big component of the DNA repair crew
The genetic disorder known as Fanconi anemia (FANC) is a heterogeneous, autosomal-recessive cancer susceptibility condition characterized by a wide array of symptoms. These include congenital malformations, progressive bone marrow failure, DNA-damage...  Read full blog post.

BRCA1 - A Critical Tumor Suppressor Gene in Women
Breast cancer 1, early onset (BRCA1) is a well-known tumor suppressor gene that was originally discovered due to its link with early-onset breast and ovarian cancer in women. The BRCA1 protein contains the following domains: RING finger, RAD51-interac...  Read full blog post.

53BP1 - DNA damage is no fun
The 53BP1 (p53 binding protein 1) was initially believed to be a p53 transcriptional enhancing partner, but it has now been established as an ataxia telangiectasia mutated (ATM) substrate. As a late DNA damage response (DDR) marker, 53BP1 appears duri...  Read full blog post.

Breast Cancer Infographic
Breast cancer is caused by malignant cells developing in breast tissue. It is the most commonly diagnosed cancer in women, but advancements in treatment options have seen the death rate decline since the 1990s. Common warning signs of breast cancer in...  Read full blog post.

Showing 1-10 of 20 blog posts - Show all blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BRCA1 Antibody and receive a gift card or discount.


Gene Symbol BRCA1