Bradykinin RB1/BDKRB1 Antibody

Images

 
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human pancreas shows positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human cervix, uterine shows moderate to strong positivity in glandular cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human liver shows very weak membranous positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related Bradykinin RB1/BDKRB1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88939
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Bradykinin RB1/BDKRB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MASSWPPLELQSSNQSQLSPQNATACDNAPEAWDLLHRVLP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BDKRB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using
NBP1-88939 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Bradykinin RB1/BDKRB1 Antibody

  • B1 bradykinin receptor
  • B1BKR
  • B1R
  • BDKRB1
  • BK-1 Receptor
  • BKB1R
  • BKR1
  • BRADYB1
  • bradykinin B1 receptor
  • Bradykinin RB1
  • bradykinin receptor 1
  • bradykinin receptor B1
  • BradykininRB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-46328
Species: Mu, Rt
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
MAB1569
Species: Hu
Applications: WB, IHC, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939) (0)

There are no reviews for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Bradykinin RB1/BDKRB1 Products

Bioinformatics Tool for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Discover related pathways, diseases and genes to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Discover more about diseases related to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939).
 

Pathways for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

View related products by pathway.

PTMs for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Learn more about PTMs related to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939).
 

Research Areas for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Find related products by research area.

Blogs on Bradykinin RB1/BDKRB1

There are no specific blogs for Bradykinin RB1/BDKRB1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Bradykinin RB1/BDKRB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BDKRB1
Entrez