Bradykinin RB1/BDKRB1 Antibody


Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human cerebral cortex shows moderate to strong positivity in neuronal cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human pancreas shows positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human cervix, uterine shows moderate to strong positivity in glandular cells.
Immunohistochemistry-Paraffin: Bradykinin RB1/BDKRB1 Antibody [NBP1-88939] - Staining of human liver shows very weak membranous positivity in hepatocytes.

Product Details

Product Discontinued
View other related Bradykinin RB1/BDKRB1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Bradykinin RB1/BDKRB1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MASSWPPLELQSSNQSQLSPQNATACDNAPEAWDLLHRVLP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Read Publication using
NBP1-88939 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Bradykinin RB1/BDKRB1 Antibody

  • B1 bradykinin receptor
  • B1BKR
  • B1R
  • BDKRB1
  • BK-1 Receptor
  • BKB1R
  • BKR1
  • bradykinin B1 receptor
  • Bradykinin RB1
  • bradykinin receptor 1
  • bradykinin receptor B1
  • BradykininRB1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, Flow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939) (0)

There are no reviews for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Bradykinin RB1/BDKRB1 Products

Bioinformatics Tool for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Discover related pathways, diseases and genes to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Discover more about diseases related to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939).

Pathways for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

View related products by pathway.

PTMs for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Learn more about PTMs related to Bradykinin RB1/BDKRB1 Antibody (NBP1-88939).

Research Areas for Bradykinin RB1/BDKRB1 Antibody (NBP1-88939)

Find related products by research area.

Blogs on Bradykinin RB1/BDKRB1

There are no specific blogs for Bradykinin RB1/BDKRB1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Bradykinin RB1/BDKRB1 Antibody and receive a gift card or discount.


Gene Symbol BDKRB1