Brachyury Antibody (5E12.)

Images

 
ELISA: Brachyury Antibody (5E12) [H00006862-M08] - Detection limit for recombinant GST tagged T is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Brachyury Antibody (5E12.) Summary

Immunogen
T (NP_003172 222 a.a. - 320 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW
Marker
Mesoderm Marker
Specificity
T (5E12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
T
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Brachyury Antibody (5E12.)

  • brachyury protein
  • Brachyury
  • MGC104817
  • Protein T
  • T brachyury (mouse) homolog
  • T brachyury homolog
  • T, brachyury homolog (mouse)
  • TF
  • TFT

Background

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
423-F8/CF
Species: Hu, Mu
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47790
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2400
Species: Hu
Applications: WB, ChIP, ICC
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00006862-M08
Species: Hu
Applications: WB, ELISA

Publications for Brachyury Antibody (H00006862-M08) (0)

There are no publications for Brachyury Antibody (H00006862-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Brachyury Antibody (H00006862-M08) (0)

There are no reviews for Brachyury Antibody (H00006862-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Brachyury Antibody (H00006862-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Brachyury Products

Bioinformatics Tool for Brachyury Antibody (H00006862-M08)

Discover related pathways, diseases and genes to Brachyury Antibody (H00006862-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for Brachyury Antibody (H00006862-M08)

Find related products by research area.

Blogs on Brachyury

There are no specific blogs for Brachyury, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Brachyury Antibody (5E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol T
Entrez
OMIM
Uniprot