BPNT1 Antibody


Western Blot: BPNT1 Antibody [NBP1-55324] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Product Discontinued
View other related BPNT1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

BPNT1 Antibody Summary

Synthetic peptides corresponding to BPNT1(3'(2'), 5'-bisphosphate nucleotidase 1) The peptide sequence was selected from the N terminal of BPNT1. Peptide sequence DRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against BPNT1 and was validated on Western blot.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for BPNT1 Antibody

  • 3'(2'), 5'-bisphosphate nucleotidase 1,3'(2')5'-bisphosphate nucleotidase 1
  • Bisphosphate 3'-nucleotidase 1
  • BPntase
  • EC 3.1.3
  • EC
  • PAP-inositol-1,4-phosphatase
  • PIP


BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB

Publications for BPNT1 Antibody (NBP1-55324) (0)

There are no publications for BPNT1 Antibody (NBP1-55324).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPNT1 Antibody (NBP1-55324) (0)

There are no reviews for BPNT1 Antibody (NBP1-55324). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BPNT1 Antibody (NBP1-55324) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional BPNT1 Products

Bioinformatics Tool for BPNT1 Antibody (NBP1-55324)

Discover related pathways, diseases and genes to BPNT1 Antibody (NBP1-55324). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPNT1 Antibody (NBP1-55324)

Discover more about diseases related to BPNT1 Antibody (NBP1-55324).

Pathways for BPNT1 Antibody (NBP1-55324)

View related products by pathway.

Research Areas for BPNT1 Antibody (NBP1-55324)

Find related products by research area.

Blogs on BPNT1

There are no specific blogs for BPNT1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BPNT1 Antibody and receive a gift card or discount.


Gene Symbol BPNT1